PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_13783.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 248aa    MW: 27456.3 Da    PI: 6.3814
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_13783.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.6e-372580661
                   zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++ 
  Rsa1.0_13783.1_g00001.1 25 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGSLRNVPVGGGCRKSRRP 80
                             58**************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.7512579IPR003851Zinc finger, Dof-type
PfamPF027018.8E-322679IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-242779IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MERTEALTSS FIWQPNANAN TEITPSCPRC GSSNTKFCYY NNYSLTQPRY FCKSCRRYWT  60
KGGSLRNVPV GGGCRKSRRP KASSSITKTG LTTNSYSSGG GSPNIDLALV YANFLNPKPD  120
KPKLQENCET DFLVEEPVGA LMEPLWSTDI GHGHHHHHHH NYEHQVEHIV DECGYNGLPP  180
FPGEELLPID KSGDWSDALL NGHNHVDVGG VTPAQIVHEP VVHFPDESND STNLLFGSWS  240
PFDFSANG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603941.11e-148PREDICTED: dof zinc finger protein DOF3.5-like
SwissprotQ9SVC51e-142DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A0D3DS581e-148A0A0D3DS58_BRAOL; Uncharacterized protein
STRINGBra006923.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-128Dof family protein